Gene Bio Systems
Recombinant Salmonella dublin Probable intracellular septation protein A(yciB)
Recombinant Salmonella dublin Probable intracellular septation protein A(yciB)
SKU:CSB-CF475106SWN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Salmonella dublin (strain CT_02021853)
Uniprot NO.:B5FU57
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLN LAWALFFIVCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Name:yciB Ordered Locus Names:SeD_A1593
Expression Region:1-179
Sequence Info:full length protein
