Gene Bio Systems
Recombinant Saccharophagus degradans Disulfide bond formation protein B(dsbB)
Recombinant Saccharophagus degradans Disulfide bond formation protein B(dsbB)
SKU:CSB-CF637462SAAX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Uniprot NO.:Q21EN9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKITKLPSYRQTALIIFAGCVGLILAALYMQEVLGLHPCPLCITQRIFIIGVGLISLIAA IHNPAALGRKVYGCLATLSGVIGAGVSARHVWLQNLPEDQVPACGPDLAYMFDAFPLLDA LKLLFAGDGNCADVVASFLGLSIPGWTFVAFVGLIAISVWQGLRKA
Protein Names:Recommended name: Disulfide bond formation protein B Alternative name(s): Disulfide oxidoreductase
Gene Names:Name:dsbB Ordered Locus Names:Sde_3585
Expression Region:1-166
Sequence Info:full length protein
