Gene Bio Systems
Recombinant Saccharomyces cerevisiae Vacuolar ATPase assembly integral membrane protein VPH2(VPH2)
Recombinant Saccharomyces cerevisiae Vacuolar ATPase assembly integral membrane protein VPH2(VPH2)
SKU:CSB-CF327127SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P32341
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFEIKLNDRITEFLRKFKNSAKSNEGIDEDIDLFLKRHAIPMQSLLFYVKEYRKDSDLQC SIKELLKPLEFEFKPKAVRGLHYSEDFKKKLEFLKYQEQELEYQSMVKRSKSVFSLQEDD ELTPSQINKQIKEQVTTVFNVLVSVISVVVAIWYWTGSSTNFPVHVRLLLCLFFGILVLV ADVVVYNSYLKKLEEAKVKEKTKVEKKKVLSKITL
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VPH2 Alternative name(s): Protein VMA12
Gene Names:Name:VPH2 Synonyms:CLS10, VMA12 Ordered Locus Names:YKL119C ORF Names:YKL520
Expression Region:1-215
Sequence Info:full length protein
