Gene Bio Systems
Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit c(VMA3)
Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit c(VMA3)
SKU:CSB-CF328546SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P25515
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTELCPVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLLFKNIVPVIMA GIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSS QQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVVC
Protein Names:Recommended name: V-type proton ATPase subunit c Short name= V-ATPase subunit c Alternative name(s): Guanine nucleotide exchange factor 2 V-ATPase 16 kDa proteolipid subunit 1 Vacuolar proton pump c subunit
Gene Names:Name:VMA3 Synonyms:CLS7, CUP5, GEF2 Ordered Locus Names:YEL027W
Expression Region:1-160
Sequence Info:full length protein
