Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P23968
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNKESKDDDMSLGKFSFSHFLYYLVLIVVIVYGLYKLFTGHGSDINFGKFLLRTSPYMWA NLGIALCVGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIFCEVVAIYGLIIAIV FSSKLTVATAENMYSKSNLYTGYSLFWAGITVGASNLICGIAVGITGATAAISDAADSAL FVKILVIEIFGSILGLLGLIVGLLMAGKASEFQ
Protein Names:Recommended name: V-type proton ATPase subunit c'' Short name= V-ATPase subunit c'' Alternative name(s): V-ATPase 22 kDa proteolipid subunit Vacuolar proton pump c'' subunit
Gene Names:Name:VMA16 Synonyms:PPA1 Ordered Locus Names:YHR026W
Expression Region:1-213
Sequence Info:full length protein