Gene Bio Systems
Recombinant Saccharomyces cerevisiae Uncharacterized protein YOR097C(YOR097C)
Recombinant Saccharomyces cerevisiae Uncharacterized protein YOR097C(YOR097C)
SKU:CSB-CF622457SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:Q12274
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDLKRDWLRWKITIGSGPGSIVLDFPSFLVGCVFTTMMGPILQKLIGKLLVGLITVCKFL VIIGSIVFVIGVASKKYTYDDFKVSIKRSGEPGESHDMRTEPKRTAKTATVPMEKDEGVG SYNYFEIPITKETSTIPYINCDGTSSLRKPPNGPSSVGLSNSNRYENFINMARHK
Protein Names:Recommended name: Uncharacterized protein YOR097C
Gene Names:Ordered Locus Names:YOR097C ORF Names:YOR3180c
Expression Region:1-175
Sequence Info:full length protein
