Gene Bio Systems
Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL041C-B(YGL041C-B)
Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL041C-B(YGL041C-B)
SKU:CSB-CF664245SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:Q3E750
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MFDSSIERVTLELCFHITLSIMCGCSIYFLLLVFILTFYSSVLLHLKLYFFSSDRAIFNA
Protein Names:Recommended name: Uncharacterized protein YGL041C-B
Gene Names:Ordered Locus Names:YGL041C-B
Expression Region:1-60
Sequence Info:full length protein
