Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)
Uniprot NO.:B3LS52
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSKHKHEWTESVANSGPASILSYCASSILMTVTNKFVVNLDNFNMNFVMLFVQSLVCTVT LCILRIVGVANF
Protein Names:Recommended name: Uncharacterized protein SCRG_04509
Gene Names:ORF Names:SCRG_04509
Expression Region:1-72
Sequence Info:full length protein