>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: SMT3
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Delivery time: 3-7 business days
Uniprot ID: Q12306
AA Sequence: SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 2-98aa
Protein length: Full Length
MW: 27.1 kDa
Alternative Name(s):
Relevance: Not known; suppressor of MIF2 mutations.
Reference: Ulp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regulatory element essential for cell growth in yeast.Mossessova E., Lima C.D.Mol. Cell 5:865-876(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.