Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial(SDH3)

Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial(SDH3)

SKU:CSB-CF333794SVG

Regular price $2,087.40 CAD
Regular price Sale price $2,087.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P33421

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:NVASEMNTKAAIAEEQILNKQRAKRPISPHLTIYQPQLTWYLSSLHRISLVLMGLGFYLF TILFGVSGLLGLGLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAIHYGGAIRHLIWDTAK ELTLKGVYRTGYALIGFTAVLGTYLLTL

Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial

Gene Names:Name:SDH3 Synonyms:CYB3 Ordered Locus Names:YKL141W ORF Names:YKL4

Expression Region:51-198

Sequence Info:full length protein

View full details