Gene Bio Systems
Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial(SDH3)
Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial(SDH3)
SKU:CSB-CF333794SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P33421
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:NVASEMNTKAAIAEEQILNKQRAKRPISPHLTIYQPQLTWYLSSLHRISLVLMGLGFYLF TILFGVSGLLGLGLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAIHYGGAIRHLIWDTAK ELTLKGVYRTGYALIGFTAVLGTYLLTL
Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial
Gene Names:Name:SDH3 Synonyms:CYB3 Ordered Locus Names:YKL141W ORF Names:YKL4
Expression Region:51-198
Sequence Info:full length protein
![Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial(SDH3)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_8b030766-69b9-4c16-928c-9ba471bc92e3.jpg?v=1659245139&width=1445)