Gene Bio Systems
Recombinant Saccharomyces cerevisiae Signal peptidase complex subunit SPC1(SPC1)
Recombinant Saccharomyces cerevisiae Signal peptidase complex subunit SPC1(SPC1)
SKU:CSB-CF343622SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P46965
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISC VITLICVLPAYPWYNKQKLRWAQPKIEINVDQYD
Protein Names:Recommended name: Signal peptidase complex subunit SPC1 Alternative name(s): Microsomal signal peptidase subunit 1
Gene Names:Name:SPC1 Ordered Locus Names:YJR010C-A ORF Names:YJR010BW
Expression Region:1-94
Sequence Info:full length protein
