Gene Bio Systems
Recombinant Saccharomyces cerevisiae Ribonuclease MRP protein subunit RMP1(RMP1)
Recombinant Saccharomyces cerevisiae Ribonuclease MRP protein subunit RMP1(RMP1)
SKU:CSB-CF621499SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:Q12530
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDEMDNVIRSLEQEYRLILLLNHRNKNQHRAASWYGSFNEMKRNCGQIITLFSSRRLQAK RLKDVEWVKLHRLLQRALFRQLKRWYWQFNGVIALGQFVTLGCTLVTLLANVRALYMRLW EINETEFIRCGCLIKNLPRTKAKSVVNDVEELGEIIDEDIGNNVQENELVITSIPKPLTE NCKKKKKRKKKNKSAIDGIFG
Protein Names:Recommended name: Ribonuclease MRP protein subunit RMP1 Alternative name(s): RNA-processing protein RMP1 RNase MRP 23.6 kDa subunit
Gene Names:Name:RMP1 Ordered Locus Names:YLR145W
Expression Region:1-201
Sequence Info:full length protein
