Gene Bio Systems
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YOR218C(YOR218C)
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YOR218C(YOR218C)
SKU:CSB-CF615482SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:Q12249
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNKSCFRFPFFATTRFTGGSLPLRRFGFLLDKFILLQVCATILCFFIICGNWIVICVNDI FEIGGASTGANTTTTNSTTCSVNCDWMCHTVVFPRESTFNRSWYLFDNGCGHIRTYEKLH NRIPVFFGQIVIVHYLYDR
Protein Names:Recommended name: Putative uncharacterized protein YOR218C
Gene Names:Ordered Locus Names:YOR218C ORF Names:O5008, O5042, YOR50-8
Expression Region:1-139
Sequence Info:full length protein
