Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YMR254C (YMR254C)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YMR254C (YMR254C)

SKU:CSB-CF312964SVG

Regular price $2,020.20 CAD
Regular price Sale price $2,020.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q04838

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVPLILLILLFSKFSTFLRPVNHVLVTKYTAIVNTKWQTTPSIIDVTYTMHVFYMTIILI LVRKQMQSIHAFLGSLCLPSHVLDFSIVRDILSWYFLETVAV

Protein Names:Recommended name: Putative uncharacterized protein YMR254C

Gene Names:Ordered Locus Names:YMR254C ORF Names:YM9920.08C

Expression Region:1-102

Sequence Info:full length protein

View full details