1 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Putative increased recombination centers protein 11(IRC11)

Recombinant Saccharomyces cerevisiae Putative increased recombination centers protein 11(IRC11)

CSB-CF613234SVG

$2,100.00 CAD
$2,100.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q12479

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTWMVKLLRQMISMQSQYGAALGATCLLHYLTTSLSIRFFFHDLTVRKHEVMPLGMDYYY LYAIGKDPSHPEIRGSVRKILEKYKTKADKANCALALEAISEHARSVYEYFGFKTYLVFQ FGVGEVNSKGEPDPQGKGFTAYLMLYHKDADTIFHA

Protein Names:Recommended name: Putative increased recombination centers protein 11

Gene Names:Name:IRC11 Ordered Locus Names:YOR013W ORF Names:O2612, OR26.03, YOL303.3

Expression Region:1-156

Sequence Info:full length protein

View full details