Gene Bio Systems
Recombinant Saccharomyces cerevisiae Protein YOP1(YOP1)
Recombinant Saccharomyces cerevisiae Protein YOP1(YOP1)
SKU:CSB-CF621483SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:Q12402
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SEYASSIHSQMKQFDTKYSGNRILQQLENKTNLPKSYLVAGLGFAYLLLIFINVGGVGEI LSNFAGFVLPAYLSLVALKTPTSTDDTQLLTYWIVFSFLSVIEFWSKAILYLIPFYWFLK TVFLIYIALPQTGGARMIYQKIVAPLTDRYILRDVSKTEKDEIRASVNEASKATGASVH
Protein Names:Recommended name: Protein YOP1 Alternative name(s): YIP1 partner protein 1 YPT-interacting protein 2
Gene Names:Name:YOP1 Synonyms:YIP2 Ordered Locus Names:YPR028W ORF Names:YP9367.08
Expression Region:2-180
Sequence Info:full length protein
