Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Protein ILM1(ILM1)

Recombinant Saccharomyces cerevisiae Protein ILM1(ILM1)

SKU:CSB-CF342864SVG

Regular price $2,168.60 CAD
Regular price Sale price $2,168.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P47155

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAQALNSTNIAFFRVAFLFTIAFFCLKNVNSILQNTYFIVLTQAMNLPQLTLSRYSGQLG LFALLFTLNGVHDLIPLLENNVKYFQSVVPVRLLIFFILTSISYLWESNFYVHNNSVFIY CFAEVWINFLLYNAIREEKNEEFKRLNQFMVNDEDIEEPQPFTVKTETTEIIEIINDEEN DDEDGKDNDDNNEKGNDDSDAKK

Protein Names:Recommended name: Protein ILM1 Alternative name(s): Increased loss of mitochondrial DNA protein 1

Gene Names:Name:ILM1 Ordered Locus Names:YJR118C ORF Names:J2033

Expression Region:1-203

Sequence Info:full length protein

View full details