Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit(ERI1)

Recombinant Saccharomyces cerevisiae Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit(ERI1)

SKU:CSB-CF351787SVG

Regular price $1,969.80 CAD
Regular price Sale price $1,969.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P62651

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRPRDQGFLVLGFTYSVLLISLATFYWLRNNDSFLHYWCVLLLCPATLWLWALIAWCDSE MFASSKDE

Protein Names:Recommended name: Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit Alternative name(s): Endoplasmic reticulum-associated Ras inhibitor protein 1

Gene Names:Name:ERI1 Synonyms:RIN1 Ordered Locus Names:YPL096C-A

Expression Region:1-68

Sequence Info:full length protein

View full details