Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae pH-response regulator protein palI-RIM9(RIM9)

Recombinant Saccharomyces cerevisiae pH-response regulator protein palI-RIM9(RIM9)

SKU:CSB-CF312026SVG

Regular price $2,221.80 CAD
Regular price Sale price $2,221.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q04734

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSMIHIVVFLLAITTMFEILPLITVPVTKYLSLSSFRNHYYGLFGWCVRGQNQELMCTK MKIGYDSTDVDSSGHVLTLPSNSKVVVSNLLVVHPISLAFTGTLLILAVIIMVTPLGDSP EMLLFTALFSLPTFMLCLLCFLVDILLFISKLDWPGWLMLAATISVALCCSMLWVMRRVV SVKKYESQQSIAHACSMEQYSISDIYQSKQNGNSSEYEVAPTHTDSLIAPEVTYRGFIE

Protein Names:Recommended name: pH-response regulator protein palI/RIM9 Alternative name(s): Regulator of IME2 protein 9

Gene Names:Name:RIM9 Ordered Locus Names:YMR063W ORF Names:YM9916.02

Expression Region:1-239

Sequence Info:full length protein

View full details