Gene Bio Systems
Recombinant Saccharomyces cerevisiae Peroxisomal membrane protein PEX34(PEX34)
Recombinant Saccharomyces cerevisiae Peroxisomal membrane protein PEX34(PEX34)
SKU:CSB-CF333086SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P25584
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM VLIYPGTRLFKRLSNIITLCRIIV
Protein Names:Recommended name: Peroxisomal membrane protein PEX34 Alternative name(s): Peroxin-34
Gene Names:Name:PEX34 Ordered Locus Names:YCL056C ORF Names:YCL433, YCL56C
Expression Region:1-144
Sequence Info:full length protein
