Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Mitochondrial phosphate carrier protein 2(PIC2)

Recombinant Saccharomyces cerevisiae Mitochondrial phosphate carrier protein 2(PIC2)

SKU:CSB-CF331116SVG

Regular price $2,312.80 CAD
Regular price Sale price $2,312.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P40035

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGF RKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAE FLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYT MCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKIN SERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGLPTTG

Protein Names:Recommended name: Mitochondrial phosphate carrier protein 2 Alternative name(s): Phosphate transport protein 2 Short name= PTP 2 Pi carrier isoform 2 mPic 2

Gene Names:Name:PIC2 Ordered Locus Names:YER053C

Expression Region:1-300

Sequence Info:full length protein

View full details