Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Mitochondrial organizing structure protein 2(MOS2)

Recombinant Saccharomyces cerevisiae Mitochondrial organizing structure protein 2(MOS2)

SKU:CSB-CF343459SVG

Regular price $1,976.25 CAD
Regular price Sale price $1,976.25 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P50087

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTKDFYRQLDPVEEKIVPPENAIVISSEAKEATVNEKEAKQGVLSQRVMKYIGENELVDG ISVRDPDYLKRFFNERRKQFSAKWDKVTNKIDDIAGRYYAREESFTSTIASLHTDPNERL IPGLLSILVASMTGSVLARRRTWLLRATMPIILGSCCFAYAMPTTFRNTMGLIHNLEMNT FPHFTERQDRVWKETKRLSTASVQYYYDAKKWLNKDVEKTGNAIKNWTGVNVK

Protein Names:Recommended name: Mitochondrial organizing structure protein 2 Short name= MitOS2 Alternative name(s): Mitochondrial inner membrane organization component of 27 kDa

Gene Names:Name:MOS2 Synonyms:MIO27 Ordered Locus Names:YGR235C ORF Names:G8575

Expression Region:1-233

Sequence Info:full length protein

View full details