Recombinant Saccharomyces cerevisiae Mitochondrial organizing structure protein 1(MOS1)

SKU: CSB-CF839427SVG

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q96VH5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV

Protein Names:Recommended name: Mitochondrial organizing structure protein 1 Short name= MitOS1 Alternative name(s): Mitochondrial inner membrane organization component of 10 kDa

Gene Names:Name:MOS1 Synonyms:MIO10 Ordered Locus Names:YCL057C-A

Expression Region:1-97

Sequence Info:full length protein