Recombinant Saccharomyces cerevisiae  Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2(OST2)

Recombinant Saccharomyces cerevisiae Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2(OST2)

CSB-CF341657SVG
Regular price
$1,471.00 CAD
Sale price
$1,471.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P46964

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AKAPKANTPKVTSTSSAVLTDFQETFKTSKRAYFAQIEKYPKLKLIDTFCFFLVLLGVIQ CTFIILIRDNFPFNAFLAGFIICVGQFVLLMSLRLQLCNSFPGISKNRAFAEFIVASLIL HFVCLHFIN

Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2 Short name= Oligosaccharyl transferase subunit OST2 EC= 2.4.1.119 Alternative name(s): Oligosaccharyl transferase 16 kDa subunit Oligos

Gene Names:Name:OST2 Ordered Locus Names:YOR103C ORF Names:YOR3211C

Expression Region:2-130

Sequence Info:full length protein

Your list is ready to share