Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Autophagy-related protein 33(ATG33)

Recombinant Saccharomyces cerevisiae Autophagy-related protein 33(ATG33)

SKU:CSB-CF514970SVN

Regular price $2,160.20 CAD
Regular price Sale price $2,160.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)

Uniprot NO.:C8ZDW3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVCLAITKGIAVSSIGLYSGLLASASLITSTTPLEVLTGSLTPTLTTLKNAATALGAFA STFFCVSFFGAPPSLRHPYLLYGMLAAPLSSFVLGCASNYQSRKYSKVSKESSLFPEDSK PAASELSDSIIDLGEDNHASENTPRDGKPAATTVSKPAEALHTGPPIHTKNLIAATAIAI VGFVQAVIGVYGEGQFI

Protein Names:Recommended name: Autophagy-related protein 33

Gene Names:Name:ATG33 ORF Names:EC1118_1L7_2256g

Expression Region:1-197

Sequence Info:full length protein

View full details