Gene Bio Systems
Recombinant Saccharomyces cerevisiae ATP synthase subunit 9, mitochondrial(OLI1)
Recombinant Saccharomyces cerevisiae ATP synthase subunit 9, mitochondrial(OLI1)
SKU:CSB-CF352843SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P61829
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEA TGLFCLMVSFLLLFGV
Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein Oligomycin resistance protein 1
Gene Names:Name:OLI1 Synonyms:ATP9, OLI3, PHO2 Ordered Locus Names:Q0130
Expression Region:1-76
Sequence Info:full length protein
