Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 36, mitochondrial(AIM36)

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 36, mitochondrial(AIM36)

SKU:CSB-CF509784SVL

Regular price $2,186.80 CAD
Regular price Sale price $2,186.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain JAY291) (Baker's yeast)

Uniprot NO.:C7GQ96

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SSTDSSTKRSNKSDKIDAPGFKKIFLVAIIGTVIFVKTVQSLDKNKPKTTLSEEEFENVV KGLKRRVAIFPQGEVDIKFSLSPSIEETRKVLQKSQGDDINELQFVDPVKVIDYYRTLRD DRYEALLNEYYKKYGCDTYAYNLPTGMLVMLLGRYFKENFKAGDKLVVVNFPHSIADATR FENEVSIVSKIFVPRKLSGSDVCKYYETVGKADII

Protein Names:Recommended name: Altered inheritance of mitochondria protein 36, mitochondrial Alternative name(s): Found in mitochondria protein 39

Gene Names:Name:AIM36 Synonyms:FMP39 ORF Names:C1Q_02491

Expression Region:41-255

Sequence Info:full length protein

View full details