Gene Bio Systems
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)
SKU:CSB-CF512102SVN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
Uniprot NO.:C8ZEH4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSRMPSSFDVTERDLDDMTFGERIIYHCKKQPLVPIGCLLTTGAVILAAQNVRLGNKWKA QYYFRWRVGLQAATLVALVAGSFIYGTSGKELKAKEEQLKEKAKMREKLWIQELERREEE TEARRKRAELARMKTLENEEEIKNLEKELSDLENKLGKK
Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial
Gene Names:Name:AIM31 ORF Names:EC1118_1M3_1200g
Expression Region:1-159
Sequence Info:full length protein
