Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae 3-hydroxyacyl-CoA dehydratase PHS1(PHS1)

Recombinant Saccharomyces cerevisiae 3-hydroxyacyl-CoA dehydratase PHS1(PHS1)

SKU:CSB-CF328181SVG

Regular price $2,189.60 CAD
Regular price Sale price $2,189.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P40857

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKKLASPLSFLPLYNLLSAVGWSYLLYLVISLYPKVGQPAFFYQTKNVATLVQCGAIIE IINSFLGVVRSPLLTTVAQVSSRLLVVLGIFQLLPNTSGVQSVVYISLLLAWSITEIVRY LYYFFMLVFKNGAPKILILLRYNLFWILYPTGVASELRIIYCALNAAESQYSLLYKRILI AAMLAYIPGFPMLFLHMVAQRKKVMKSLRSSFGKKLI

Protein Names:Recommended name: 3-hydroxyacyl-CoA dehydratase PHS1 Short name= HACD EC= 4.2.1.- Alternative name(s): PTPLA homolog involved in sphingolipid biosynthesis protein 1

Gene Names:Name:PHS1 Ordered Locus Names:YJL097W ORF Names:J0902

Expression Region:1-217

Sequence Info:full length protein

View full details