Recombinant Rickettsia typhi  Succinate dehydrogenase cytochrome b556 subunit(sdhC)

Recombinant Rickettsia typhi Succinate dehydrogenase cytochrome b556 subunit(sdhC)

CSB-CF737947RNE
Regular price
$1,466.00 CAD
Sale price
$1,466.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Uniprot NO.:Q68XP1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTKIKQEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFVVSILVWWLILSKYDNNY LQLARCCIIKICLVAFSYAWCYHLCNGIRHLFWDIGYGFSIRAVNITGWCVVVCSILLTM LLWV

Protein Names:Recommended name: Succinate dehydrogenase cytochrome b556 subunit Short name= Cytochrome b-556

Gene Names:Name:sdhC Ordered Locus Names:RT0115

Expression Region:1-124

Sequence Info:full length protein

Your list is ready to share