Gene Bio Systems
Recombinant Rickettsia typhi Succinate dehydrogenase cytochrome b556 subunit(sdhC)
Recombinant Rickettsia typhi Succinate dehydrogenase cytochrome b556 subunit(sdhC)
SKU:CSB-CF737947RNE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Uniprot NO.:Q68XP1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTKIKQEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFVVSILVWWLILSKYDNNY LQLARCCIIKICLVAFSYAWCYHLCNGIRHLFWDIGYGFSIRAVNITGWCVVVCSILLTM LLWV
Protein Names:Recommended name: Succinate dehydrogenase cytochrome b556 subunit Short name= Cytochrome b-556
Gene Names:Name:sdhC Ordered Locus Names:RT0115
Expression Region:1-124
Sequence Info:full length protein