Gene Bio Systems
Recombinant Rickettsia prowazekii Uncharacterized protein RP436 (RP436)
Recombinant Rickettsia prowazekii Uncharacterized protein RP436 (RP436)
SKU:CSB-CF516941RMY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rickettsia prowazekii (strain Madrid E)
Uniprot NO.:O05963
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNQFEAYSLLFVDSFVSNLIISFQNELIFHSMQMLVGYNRLIMLLVAICSSLSGNTVNYL FGKIVLNIFYASKNEQNILRHKNLTKLYYQYETFIIFLISFPFWGCFVSLFSGFFKTKFL KFLSIGCLAKACYYASKIYIF
Protein Names:Recommended name: Uncharacterized protein RP436
Gene Names:Ordered Locus Names:RP436
Expression Region:1-141
Sequence Info:full length protein
