Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia felis SURF1-like protein(RF_0175)

Recombinant Rickettsia felis SURF1-like protein(RF_0175)

SKU:CSB-CF687097RMT

Regular price $2,203.60 CAD
Regular price Sale price $2,203.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)

Uniprot NO.:Q4UN32

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKTNLVVLITFTILISLGFWQLSRLKEKKLFLASMQANLTSPAINLAEIQDSLPYHKVKI TGQFLPNKDIYLYGRRSMSSGKDGYYLVTPFKTIEDKVILVARGWFSNRNKIIITQATND RQHEIIGVTMPSEKTRSYLPANDIKNNVWLTLDLKEASQTLELNLEDFYIIAEGKDISNL DILLPLSINHLAAIRNDHLEYALTWFGLAISLIVIYVIYRRNVISV

Protein Names:Recommended name: SURF1-like protein

Gene Names:Ordered Locus Names:RF_0175

Expression Region:1-226

Sequence Info:full length protein

View full details