Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia felis Putative glutamine transport system permease protein glnP(glnP)

Recombinant Rickettsia felis Putative glutamine transport system permease protein glnP(glnP)

SKU:CSB-CF706192RMT

Regular price $2,191.00 CAD
Regular price Sale price $2,191.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)

Uniprot NO.:Q4UKC4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFEYLIKFYPKILFIVEGTLVTLKYSVIAVIFGLVIGMLLAICKVNKNRALRLFANFYTS IFRGTPLLIQLSIIYFASPYIIGVKFSVFMAGAISFSLNSGAYVSEVIRAGINAVDKGQF EAAVALAIPKFLIMKDIILPQAVKNIFPSLVNELVNLVKESAIISMLGEMDLMRRAQIVS IETYNYFFPMFIAACCYYILVMLISFIAKIIEKKMIVN

Protein Names:Recommended name: Putative glutamine transport system permease protein glnP

Gene Names:Name:glnP Ordered Locus Names:RF_1156

Expression Region:1-218

Sequence Info:full length protein

View full details