Gene Bio Systems
Recombinant Rickettsia conorii Putative Na(+)-H(+) antiporter nhaA homolog(nhaA)
Recombinant Rickettsia conorii Putative Na(+)-H(+) antiporter nhaA homolog(nhaA)
SKU:CSB-CF838877RMS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Uniprot NO.:Q92FX2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVESGIHDTLCRAIIALFIPVNIKGEFNTSFKKLENLTRPFVNYFILPLFVFMNSGILLE YFAFKGICSNSILALIYGIIFGLFVGKQLGIMLFSYPFVKFKLCNLPSDTSWLKFYSIAI LGGIGFTLSLFIGSILRLRAAALQTL
Protein Names:Recommended name: Putative Na(+)/H(+) antiporter nhaA homolog
Gene Names:Name:nhaA Ordered Locus Names:RC1355
Expression Region:1-146
Sequence Info:full length protein
