Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia bellii Probable intracellular septation protein A(RBE_0324)

Recombinant Rickettsia bellii Probable intracellular septation protein A(RBE_0324)

SKU:CSB-CF638437RAAI

Regular price $2,135.00 CAD
Regular price Sale price $2,135.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rickettsia bellii (strain RML369-C)

Uniprot NO.:Q1RJQ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFKLLSEIGPVVAFFAGFFYGGGIQSATLYMLITSVICITLCYIIDKKVSRLSIISTAVL LVSGIITLISGDSMYIKIKPTILYVIFGIIFLTSGIKKNPFIKYALESIIRLKEESWITL SYRTATFFFFMAIVNEIVWRNFPDETWVKFKVFGVVPITFVFILLQLPLLLKNKLPDSKI

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:RBE_0324

Expression Region:1-180

Sequence Info:full length protein

View full details