Gene Bio Systems
Recombinant Rickettsia africae Probable intracellular septation protein A (RAF_ORF0501)
Recombinant Rickettsia africae Probable intracellular septation protein A (RAF_ORF0501)
SKU:CSB-CF503888RMN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rickettsia africae (strain ESF-5)
Uniprot NO.:C3PNB2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKLLSEIGPVIAFFAGFFYGGGIQHATLYMLITSVICITLCYVIDKKVSKLSIISTTVL LVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWITL SYRTAAFFFFMAVVNEVVWRNCSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Ordered Locus Names:RAF_ORF0501
Expression Region:1-180
Sequence Info:full length protein
