Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodospirillum rubrum NAD(P) transhydrogenase subunit alpha part 2(pntAB)

Recombinant Rhodospirillum rubrum NAD(P) transhydrogenase subunit alpha part 2(pntAB)

SKU:CSB-CF652501RMB

Regular price $2,074.80 CAD
Regular price Sale price $2,074.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255)

Uniprot NO.:Q2RSB3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEDKNILVEGFNQLSQQALELSQHAQALALQASHAVLPAAAATEGASEFWWLMTVFVLAC FIGFYVVWSVTPALHSPLMGVTNAISSVIVVGALIATGPEAFSASKVLGFFAILLASVNI FGGFIVTQRMLAMFKKKQK

Protein Names:Recommended name: NAD(P) transhydrogenase subunit alpha part 2 EC= 1.6.1.2 Alternative name(s): Nicotinamide nucleotide transhydrogenase subunit alpha 2 Proton-translocating transhydrogenase component 2 Pyridine nucleotide transhydr

Gene Names:Name:pntAB Synonyms:nntA2 Ordered Locus Names:Rru_A2182

Expression Region:1-139

Sequence Info:full length protein

View full details