Gene Bio Systems
Recombinant Rhodospirillum rubrum ATP synthase subunit b'(atpG)
Recombinant Rhodospirillum rubrum ATP synthase subunit b'(atpG)
SKU:CSB-CF650144RMB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255)
Uniprot NO.:Q2RPA6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPQFDPSSFPSQIVWLVIALVAMYFVMSRLAIPRLAEVLEQRQRLINDDLKQAEALKAET EAAIAAYETALAEARARAHDEIRAVTEAAAKAAEARNAEVAKALNTRIKDGEARIVQARD EALTHVREVAGAVASDIVGKLAGLRVDDAALTAAVAAAIKE
Protein Names:Recommended name: ATP synthase subunit b' Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II F-type ATPase subunit b' Short name= F-ATPase subunit b'
Gene Names:Name:atpG Ordered Locus Names:Rru_A3244
Expression Region:1-161
Sequence Info:full length protein
