Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodopseudomonas palustris UPF0314 protein RPA0307 (RPA0307)

Recombinant Rhodopseudomonas palustris UPF0314 protein RPA0307 (RPA0307)

SKU:CSB-CF352202RLU

Regular price $2,168.60 CAD
Regular price Sale price $2,168.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

Uniprot NO.:P61415

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSMAGAERPVSSAAGLPVRWALAVVLGLLAIQATVLFAMGRVPICTCGTVKLWHGVVMSS ENSQHLTDWYTFSHIIHGFLFYAGTWLLLRRWPWTARLIVAVLIEGAWELTENSSFIIER YRAGTISLDYYGDSIVNSVADTLAMISGFLLARWLPVTATVAIAVLFEVLVGLHIRDNLT LNVIMLIHPFDAIRQWQAGPPII

Protein Names:Recommended name: UPF0314 protein RPA0307

Gene Names:Ordered Locus Names:RPA0307

Expression Region:1-203

Sequence Info:full length protein

View full details