Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodopseudomonas palustris UPF0060 membrane protein RPD_3084(RPD_3084)

Recombinant Rhodopseudomonas palustris UPF0060 membrane protein RPD_3084(RPD_3084)

SKU:CSB-CF614429RAAG

Regular price $2,027.20 CAD
Regular price Sale price $2,027.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodopseudomonas palustris (strain BisB5)

Uniprot NO.:Q135C9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MKSPIIYVCAALAEIAGCFAFWGWLRLGKPVWWLLPGMLSLAAFAYLLTLVESQAAGRAY ASYGGIYIVASLVWLWSVENVRPDRWDVTGGCVCLIGAAIILWGPRG

Protein Names:Recommended name: UPF0060 membrane protein RPD_3084

Gene Names:Ordered Locus Names:RPD_3084

Expression Region:1-107

Sequence Info:full length protein

View full details