Gene Bio Systems
Recombinant Rhodomonas salina ATP synthase subunit b', chloroplastic(atpG)
Recombinant Rhodomonas salina ATP synthase subunit b', chloroplastic(atpG)
SKU:CSB-CF405630RIK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodomonas salina (Cryptomonas salina)
Uniprot NO.:A6MVW7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTNSLFLLAEGGLFDFNATLPLMVLQILLLMVVLNAIFYTPIARVLDERDEYIRKNLTQA SETLAKAEAITKQYEQDLAKERRDAQMIIASSQQEAQEIVAMEIKQAQKDTELLVNEATT QLNSQKEKALQALEKQVNTLSEQIKNKLLSGQLAG
Protein Names:Recommended name: ATP synthase subunit b', chloroplastic Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II
Gene Names:Name:atpG
Expression Region:1-155
Sequence Info:full length protein
