Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodomonas salina ATP synthase subunit b', chloroplastic(atpG)

Recombinant Rhodomonas salina ATP synthase subunit b', chloroplastic(atpG)

SKU:CSB-CF405630RIK

Regular price $2,098.60 CAD
Regular price Sale price $2,098.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodomonas salina (Cryptomonas salina)

Uniprot NO.:A6MVW7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTNSLFLLAEGGLFDFNATLPLMVLQILLLMVVLNAIFYTPIARVLDERDEYIRKNLTQA SETLAKAEAITKQYEQDLAKERRDAQMIIASSQQEAQEIVAMEIKQAQKDTELLVNEATT QLNSQKEKALQALEKQVNTLSEQIKNKLLSGQLAG

Protein Names:Recommended name: ATP synthase subunit b', chloroplastic Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II

Gene Names:Name:atpG

Expression Region:1-155

Sequence Info:full length protein

View full details