Gene Bio Systems
Recombinant Rhodobacter sphaeroides UPF0060 membrane protein RHOS4_03690(RHOS4_03690)
Recombinant Rhodobacter sphaeroides UPF0060 membrane protein RHOS4_03690(RHOS4_03690)
SKU:CSB-CF665730RLF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Uniprot NO.:Q3J5J7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGLSLAAYAGAALAEIAGCFAVWAWWRLGASALWLVPGALSLGTFAWLLALTPVEAAGRS YAVYGGVYVAASLLWLWAVEGVRPDRWDMGGAALVLAGAAVILWAPRG
Protein Names:Recommended name: UPF0060 membrane protein RHOS4_03690
Gene Names:Ordered Locus Names:RHOS4_03690 ORF Names:RSP_1789
Expression Region:1-108
Sequence Info:full length protein
