Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Uniprot NO.:A3PN84
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGKFIGAGLATIGLGGAGIGVGHVAGNFLAGALRNPSAAPGQMANLFVGIAFAEALGIFS FLIALLLMFAV
Protein Names:Recommended name: ATP synthase subunit c 1 Alternative name(s): ATP synthase F(0) sector subunit c 1 F-type ATPase subunit c 1 Short name= F-ATPase subunit c 1 Lipid-binding protein 1
Gene Names:Name:atpE1 Ordered Locus Names:Rsph17029_2698
Expression Region:1-71
Sequence Info:full length protein