Recombinant Rhodobacter sphaeroides ATP synthase subunit b'(atpG)

SKU: CSB-CF660475RLF

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Uniprot NO.:Q3IZ14

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:METEVHEAAGAAGHAGQAVGMPQLNFDYWPNQIFWLLVTLVAIYFLLTRVALPRIGAVLA ERRGTITNDLAAAEELKQKAVLAEKAYNEALAKARAEAQAIVAETRAAIQAELDEATAKA DAEISAKSAESEARIAEIRAGALQSVSEVAKDTAEALVAALGGKSDAAAVDAAVAARMKG

Protein Names:Recommended name: ATP synthase subunit b' Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II F-type ATPase subunit b' Short name= F-ATPase subunit b'

Gene Names:Name:atpG Synonyms:atpX Ordered Locus Names:RHOS4_26520 ORF Names:RSP_1036

Expression Region:1-180

Sequence Info:full length protein