Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodobacter sphaeroides ATP synthase subunit a(atpB)

Recombinant Rhodobacter sphaeroides ATP synthase subunit a(atpB)

SKU:CSB-CF661775RLF

Regular price $2,234.40 CAD
Regular price Sale price $2,234.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Uniprot NO.:Q3IZ12

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDQFIVKKLFCHTESTAPMNECTTNIHWYDITNVTMWMAIAVLVIAAILVLGTRRRAIVP SRSQSVAELLYGFIHNMVEEVTGHEGVKYFPYVMTLFLFVLCGNVLGLLPLSFTTTSHMA VTVPLALMVFVGVTALGFMKNGPGFLKMFWVTSAPLAIRPVLAVIEVISYFVRPVSHSIR LAGNMMAGHAVIKVIAGFASIVVVSPVVVGAVTAIYALELLVAVVQAYVFTILTCVYLRD AVGDAHH

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6

Gene Names:Name:atpB Ordered Locus Names:RHOS4_26540 ORF Names:RSP_1038

Expression Region:1-247

Sequence Info:full length protein

View full details