Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodobacter capsulatus Probable K(+)-H(+) antiporter subunit F

Recombinant Rhodobacter capsulatus Probable K(+)-H(+) antiporter subunit F

SKU:CSB-CF529095RLD

Regular price $2,004.80 CAD
Regular price Sale price $2,004.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

Uniprot NO.:O68038

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTPLLAFALTYAQFALALAACLAALRILLGPRAQDRVLALEALYVATMLLFIVTGMRMGT PFLFEAALVIAVAGFVSTVSAAKFLLRGEVIE

Protein Names:Recommended name: Probable K(+)/H(+) antiporter subunit F Alternative name(s): pH adaptation potassium efflux system protein F Short name= Pha system subunit F

Gene Names:Name:phaF Ordered Locus Names:RCAP_rcc02128

Expression Region:1-92

Sequence Info:full length protein

View full details