Gene Bio Systems
Recombinant Rhodobacter capsulatus Probable K(+)-H(+) antiporter subunit F
Recombinant Rhodobacter capsulatus Probable K(+)-H(+) antiporter subunit F
SKU:CSB-CF529095RLD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Uniprot NO.:O68038
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTPLLAFALTYAQFALALAACLAALRILLGPRAQDRVLALEALYVATMLLFIVTGMRMGT PFLFEAALVIAVAGFVSTVSAAKFLLRGEVIE
Protein Names:Recommended name: Probable K(+)/H(+) antiporter subunit F Alternative name(s): pH adaptation potassium efflux system protein F Short name= Pha system subunit F
Gene Names:Name:phaF Ordered Locus Names:RCAP_rcc02128
Expression Region:1-92
Sequence Info:full length protein
