Gene Bio Systems
Recombinant Rhodobacter capsulatus Energy-coupling factor transporter transmembrane protein BioN(bioN)
Recombinant Rhodobacter capsulatus Energy-coupling factor transporter transmembrane protein BioN(bioN)
SKU:CSB-CF516677RLD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Uniprot NO.:D5ARG9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSLALPCRSWAHRLPAALKFGLLAVAMIALMRIGSLAGQGAAVLVVAALTASLGRKAIR QSLVTLRPLVWIVAVILIWDSLQGAVAQGVLFGLRVLAMVGLANAVTLTTPLPEIVALIE RLAQPLARFGISPRIPAISVALVIRFVPVLRARHDTLAEAWRARSARKPRGKLLAPLTFS LLDDADHMADALRARGGLALPRKGRDTVGT
Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein BioN Short name= ECF transporter T component BioN
Gene Names:Name:bioN Synonyms:cbiQ3, ecfT Ordered Locus Names:RCAP_rcc03250
Expression Region:1-210
Sequence Info:full length protein
