Gene Bio Systems
Recombinant Rhodobacter capsulatus Cobalt transport protein CbiN(cbiN)
Recombinant Rhodobacter capsulatus Cobalt transport protein CbiN(cbiN)
SKU:CSB-CF529096RLD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Uniprot NO.:O68104
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSKRTLWLLAGTVALVVVPLLMGGEFGGADGQAAELIEATVPGFAPWADPLWEPPSGEV ESLFFALQAALGAFVVGLVIGRRQGAAKTREQNAPAPRSFPAE
Protein Names:Recommended name: Cobalt transport protein CbiN Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiN Short name= ECF transporter S component CbiN
Gene Names:Name:cbiN Ordered Locus Names:RCAP_rcc02036
Expression Region:1-103
Sequence Info:full length protein
