Gene Bio Systems
Recombinant Rhizobium sp. Uncharacterized protein y4bH (NGR_a00220)
Recombinant Rhizobium sp. Uncharacterized protein y4bH (NGR_a00220)
SKU:CSB-CF346242RKX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium sp. (strain NGR234)
Uniprot NO.:P55375
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHYRSQRRSVLFTAPGLIVGALAIGAAGGISVSPGDILALVEKPHLLVAVLFVGAFTGIM VEQALSRMRRQDGARGTARAGRNSARRRMPS
Protein Names:Recommended name: Uncharacterized protein y4bH
Gene Names:Ordered Locus Names:NGR_a00220 ORF Names:y4bH
Expression Region:1-91
Sequence Info:full length protein
