Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium sp. Probable amino-acid ABC transporter permease protein y4tF (NGR_a01530)

Recombinant Rhizobium sp. Probable amino-acid ABC transporter permease protein y4tF (NGR_a01530)

SKU:CSB-CF346276RKX

Regular price $2,220.40 CAD
Regular price Sale price $2,220.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium sp. (strain NGR234)

Uniprot NO.:P55660

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRTRRVYLPLKGELSMDWHDYLGPLGRGAWVTIQFTLYSMFFGAVCSFAFGIGKLSKNPF VKGFSILYIEIFRGTSLLVQLFWLFFALPIAGDMMGIDLRLSPVVAGVLALSLNLGAYGA EIVRGAIQAVSPSQYEAATALNFSSSQALWRVALPQAIPEMMPSFSNLAIAALKDTSLVS LITLHDLTFAAEQLRNFYQDSTTVYTMVLLMYFGIALVLSFFMRLIESSVTRWRGHRR

Protein Names:Recommended name: Probable amino-acid ABC transporter permease protein y4tF

Gene Names:Ordered Locus Names:NGR_a01530 ORF Names:y4tF

Expression Region:1-238

Sequence Info:full length protein

View full details